Lineage for d1aiva1 (1aiv A:1-334)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2914985Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2915074Protein Ovotransferrin [53894] (2 species)
  7. 2915075Species Chicken (Gallus gallus) [TaxId:9031] [53896] (9 PDB entries)
    Uniprot P02789
  8. 2915085Domain d1aiva1: 1aiv A:1-334 [35885]

Details for d1aiva1

PDB Entry: 1aiv (more details), 3 Å

PDB Description: apo ovotransferrin
PDB Compounds: (A:) Ovotransferrin

SCOPe Domain Sequences for d1aiva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aiva1 c.94.1.2 (A:1-334) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]}
appksvirwctisspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisld
ggqafeaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglg
rsagwnipigtllhrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpkt
kcarnapysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyk
tcnwarvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllf
kdsaimlkrvpslmdsqlylgfeyysaiqsmrkd

SCOPe Domain Coordinates for d1aiva1:

Click to download the PDB-style file with coordinates for d1aiva1.
(The format of our PDB-style files is described here.)

Timeline for d1aiva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aiva2