Lineage for d6cacb_ (6cac B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. Protein automated matches [190418] (31 species)
    not a true protein
  7. Species Klebsiella pneumoniae [TaxId:573] [189718] (102 PDB entries)
  8. Domain d6cacb_: 6cac B: [358817]
    Other proteins in same PDB: d6caca2, d6cacc2, d6cacd2
    automated match to d4eyba_
    complexed with ca, cd, co, ni, so4, zn

Details for d6cacb_

PDB Entry: 6cac (more details), 1.7900000000000003 Å

PDB Description: crystal structure of ndm-1 metallo-beta-lactamase harboring an insertion of a pro residue in l3 loop
PDB Compounds: (B:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d6cacb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cacb_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
gdqrfgdlvfrqlapnvwqhtsyldmpgfgavapsnglivrdggrvlvvdtawtddqtaq
ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhs
ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn
lgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl

SCOPe Domain Coordinates for d6cacb_ are not available.

Timeline for d6cacb_:

Domains from other chains:
(mouse over for more information)
d6caca1, d6caca2, d6cacc1, d6cacc2, d6cacd1, d6cacd2