Lineage for d1nfta_ (1nft A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522358Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2522447Protein Ovotransferrin [53894] (2 species)
  7. 2522448Species Chicken (Gallus gallus) [TaxId:9031] [53896] (9 PDB entries)
    Uniprot P02789
  8. 2522451Domain d1nfta_: 1nft A: [35881]
    N-terminal lobe only
    complexed with fe, nta, so4

Details for d1nfta_

PDB Entry: 1nft (more details), 2.1 Å

PDB Description: ovotransferrin, n-terminal lobe, iron loaded open form
PDB Compounds: (A:) protein (ovotransferrin)

SCOPe Domain Sequences for d1nfta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfta_ c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]}
ksvirwctvsspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisldggq
vfeaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglgrsa
gwnipigtlihrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpktkca
rnapysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyktcn
warvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllfkds
aimlkrvpslmdsqlylgfeyysaiqsmr

SCOPe Domain Coordinates for d1nfta_:

Click to download the PDB-style file with coordinates for d1nfta_.
(The format of our PDB-style files is described here.)

Timeline for d1nfta_: