SCOPe 2.07: Domain d6btyb1: 6bty B:1559-1683

Lineage for d6btyb1 (6bty B:1559-1683)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.0: automated matches [191388] (1 protein)
   not a true family

6. Protein automated matches [190497] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188711] (25 PDB entries)

8. Domain d6btyb1: 6bty B:1559-1683 [358808]
   Other proteins in same PDB: d6btyb2
   automated match to d1rh8a_
   complexed with o4b

Details for d6btyb1

PDB Entry: 6bty, 1.68 Å

PDB Description: crystal structure of the pi3kc2alpha c2 domain in space group p41212

PDB Compounds: (B:) Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha

SCOPe Domain Sequences for d6btyb1:

Sequence; same for both SEQRES and ATOM records:

>d6btyb1 b.7.1.0 (B:1559-1683) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iggavklsisyrngtlfimvmhikdlvtedgadpnpyvktyllpdnhktskrktkisrkt
rnptfnemlvysgysketlrqrelqlsvlsaeslrenfflggvtlplkdfnlsketvkwy
qltaa

Timeline for d6btyb1:

• d6btyb1 is new in SCOPe 2.07-stable
  
• d6btyb1 appears in the current release, SCOPe 2.08