Lineage for d6ba0b_ (6ba0 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510775Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2510776Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2510777Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins)
    automatically mapped to Pfam PF01156
  6. 2510818Protein automated matches [190287] (4 species)
    not a true protein
  7. 2510819Species Gardnerella vaginalis [TaxId:879307] [358800] (1 PDB entry)
  8. 2510821Domain d6ba0b_: 6ba0 B: [358803]
    automated match to d1masa_
    complexed with ca, cl

Details for d6ba0b_

PDB Entry: 6ba0 (more details), 2.03 Å

PDB Description: pyrimidine-specific ribonucleoside hydrolase from gardnerella vaginalis
PDB Compounds: (B:) Cytidine/uridine-specific hydrolase

SCOPe Domain Sequences for d6ba0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ba0b_ c.70.1.1 (B:) automated matches {Gardnerella vaginalis [TaxId: 879307]}
mttiildcdpghddamaillalgnpnidllgvttvggnqslekvtynaratlemahatni
pvhagcdrpmirplevaaavhgetgldgvtlpeptrpldeghavnwiidtimshepgtit
lvptgpltniamavrleprivsrvkevvlmgggyhvgnwsavaefnikvdpeaahvvfne
dwpitmvgldlthqalctpevqaridaigtplsafasglmdffrkayknnqdfidppvhd
pctvaylidhsvvqtrrcpvdveikgdltlgmtvadlrgpepsadkchtqvatkldfnkf
wdliidalkelk

SCOPe Domain Coordinates for d6ba0b_:

Click to download the PDB-style file with coordinates for d6ba0b_.
(The format of our PDB-style files is described here.)

Timeline for d6ba0b_: