SCOPe 2.02: Domain d1tfaa_: 1tfa A:

Lineage for d1tfaa_ (1tfa A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Ovotransferrin [53894] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [53896] (10 PDB entries)
   Uniprot P02789

8. Domain d1tfaa_: 1tfa A: [35880]
   N-terminal lobe only
   complexed with so4

Details for d1tfaa_

PDB Entry: 1tfa, 1.9 Å

PDB Description: ovotransferrin, n-terminal lobe, apo form

PDB Compounds: (A:) protein (ovotransferrin)

SCOPe Domain Sequences for d1tfaa_:

Sequence; same for both SEQRES and ATOM records:

>d1tfaa_ c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]}
ksvirwctvsspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisldggq
vfeaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglgrsa
gwnipigtlihrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpktkca
rnapysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyktcn
warvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllfkds
aimlkrvpslmdsqlylgfeyysaiqsmr

Timeline for d1tfaa_:

• d1tfaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1tfaa_ appears in SCOPe 2.01
  
• d1tfaa_ appears in SCOPe 2.03
  
• d1tfaa_ appears in the current release, SCOPe 2.08