Lineage for d6cylb2 (6cyl B:91-198)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946391Species Hypocrea jecorina [TaxId:431241] [340063] (6 PDB entries)
  8. 2946397Domain d6cylb2: 6cyl B:91-198 [358792]
    Other proteins in same PDB: d6cyla1, d6cylb1, d6cylc1, d6cyld1
    automated match to d5tira2
    complexed with mn; mutant

Details for d6cylb2

PDB Entry: 6cyl (more details), 1.8 Å

PDB Description: crystal structure of superoxide dismutase double mutant (g74q+q149g) from trichoderma reesei
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d6cylb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cylb2 d.44.1.0 (B:91-198) automated matches {Hypocrea jecorina [TaxId: 431241]}
pdadpasapeltaeiaktwgsldkfkeamgkallgiqgsgwgwlvkegsglrivttkdgd
pvvggevpvfgidmwehayylqylngkaayvdniwkvinwktaeqrfk

SCOPe Domain Coordinates for d6cylb2:

Click to download the PDB-style file with coordinates for d6cylb2.
(The format of our PDB-style files is described here.)

Timeline for d6cylb2: