SCOPe 2.07: Domain d1aova2: 1aov A:335-686

Lineage for d1aova2 (1aov A:335-686)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Ovotransferrin [53894] (2 species)

7. Species Duck (Anas platyrhynchos) [TaxId:8839] [53895] (5 PDB entries)

8. Domain d1aova2: 1aov A:335-686 [35879]

Details for d1aova2

PDB Entry: 1aov, 4 Å

PDB Description: apo duck ovotransferrin

PDB Compounds: (A:) apo-ovotransferrin

SCOPe Domain Sequences for d1aova2:

Sequence; same for both SEQRES and ATOM records:

>d1aova2 c.94.1.2 (A:335-686) Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 8839]}
qltvgprenkiqwcavgkdekskcdrwsvvsngevectilddnkdcivkitkgeadaisl
dggfvytagvcglvpvvgesyedetqcskdeeqpayyfavavvkkssaitwnnlqgkksc
htavgrtagwnipmglihnktgscdfddyfsegcapgsppnsrlcklcqgsgenllekcv
asshekyygytgalrclveqgdvafikhstvgenvsgsnkddwakgltrddfellctngk
raktmdyktchlakvpthavvarpekankirellegqeklfglhgtekerfmmfqsqtkd
llfkaltkclvklrqgitykeflgdeyyasvaslntcnpsdllqvctfledk

Timeline for d1aova2:

• d1aova2 first appeared (with stable ids) in SCOP 1.55, called d1aov_2
  
• d1aova2 appears in SCOPe 2.06
  
• d1aova2 appears in the current release, SCOPe 2.08