Lineage for d1aov_2 (1aov 335-686)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.2: Transferrin [53888] (3 proteins) 
Protein Ovotransferrin [53894] (2 species) 
Species Duck (Anas platyrhynchos) [TaxId:8839] [53895] (3 PDB entries) 
Domain d1aov_2: 1aov 335-686 [35879]
Details for d1aov_2
PDB Entry: 1aov (more details), 4 Å
PDB Description: apo duck ovotransferrin
SCOP Domain Sequences for d1aov_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aov_2 c.94.1.2 (335-686) Ovotransferrin {Duck (Anas platyrhynchos)}
qltvgprenkiqwcavgkdekskcdrwsvvsngevectilddnkdcivkitkgeadaisl
dggfvytagvcglvpvvgesyedetqcskdeeqpayyfavavvkkssaitwnnlqgkksc
htavgrtagwnipmglihnktgscdfddyfsegcapgsppnsrlcklcqgsgenllekcv
asshekyygytgalrclveqgdvafikhstvgenvsgsnkddwakgltrddfellctngk
raktmdyktchlakvpthavvarpekankirellegqeklfglhgtekerfmmfqsqtkd
llfkaltkclvklrqgitykeflgdeyyasvaslntcnpsdllqvctfledk
SCOP Domain Coordinates for d1aov_2:
Click to download the PDB-style file with coordinates for d1aov_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aov_2:
- d1aov_2 appears in SCOP 1.57
- d1aov_2 appears in the current release, SCOPe 2.08, called d1aova2
View in 3D
