Lineage for d5zojb_ (5zoj B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778064Family b.26.1.1: SMAD domain [49880] (5 proteins)
  6. 2778102Protein automated matches [323874] (1 species)
    not a true protein
  7. 2778103Species Human (Homo sapiens) [TaxId:9606] [323875] (2 PDB entries)
  8. 2778108Domain d5zojb_: 5zoj B: [358785]
    automated match to d1mk2a_
    protein/DNA complex

Details for d5zojb_

PDB Entry: 5zoj (more details), 2.79 Å

PDB Description: crystal structure of human smad2-man1 complex
PDB Compounds: (B:) Mothers against decapentaplegic homolog 2

SCOPe Domain Sequences for d5zojb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zojb_ b.26.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnrnatvemtrrh
igrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqefa
allaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwldk
vltqm

SCOPe Domain Coordinates for d5zojb_:

Click to download the PDB-style file with coordinates for d5zojb_.
(The format of our PDB-style files is described here.)

Timeline for d5zojb_: