![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.2: Transferrin [53888] (4 proteins) further duplication: composed of two two-domain lobes |
![]() | Protein Ovotransferrin [53894] (2 species) |
![]() | Species Duck (Anas platyrhynchos) [TaxId:8839] [53895] (5 PDB entries) |
![]() | Domain d1aova1: 1aov A:1-334 [35878] |
PDB Entry: 1aov (more details), 4 Å
SCOPe Domain Sequences for d1aova1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aova1 c.94.1.2 (A:1-334) Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 8839]} appkttvrwctissaeekkcnslkdhmqqervtlscvqkatyldcikaisnneadaisld ggqvfeaglapyklkpiaaevyersggsttsyyavavvkkgtdfmikdlrgktschtglg rsagwnipigtlihrediewegiesgiseqavakffsascvpgatieqklcrqckgdakt kclrngpysgysgafqclkdgkgdvafvkhttvqenapeekdeyellcldgsrqpvdsyk tcnwarvaahavvarddskiddiwsflgmqayslgvdttsdfhlfgppgkkdpvlkdllf kdsaimlkrvpelmdsqlylgfeyysaiqslrkd
Timeline for d1aova1: