Lineage for d1aova1 (1aov A:1-334)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1391520Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 1391598Protein Ovotransferrin [53894] (2 species)
  7. 1391615Species Duck (Anas platyrhynchos) [TaxId:8839] [53895] (5 PDB entries)
  8. 1391621Domain d1aova1: 1aov A:1-334 [35878]

Details for d1aova1

PDB Entry: 1aov (more details), 4 Å

PDB Description: apo duck ovotransferrin
PDB Compounds: (A:) apo-ovotransferrin

SCOPe Domain Sequences for d1aova1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aova1 c.94.1.2 (A:1-334) Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 8839]}
appkttvrwctissaeekkcnslkdhmqqervtlscvqkatyldcikaisnneadaisld
ggqvfeaglapyklkpiaaevyersggsttsyyavavvkkgtdfmikdlrgktschtglg
rsagwnipigtlihrediewegiesgiseqavakffsascvpgatieqklcrqckgdakt
kclrngpysgysgafqclkdgkgdvafvkhttvqenapeekdeyellcldgsrqpvdsyk
tcnwarvaahavvarddskiddiwsflgmqayslgvdttsdfhlfgppgkkdpvlkdllf
kdsaimlkrvpelmdsqlylgfeyysaiqslrkd

SCOPe Domain Coordinates for d1aova1:

Click to download the PDB-style file with coordinates for d1aova1.
(The format of our PDB-style files is described here.)

Timeline for d1aova1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aova2