Lineage for d5zoja_ (5zoj A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387735Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2387736Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2387737Family b.26.1.1: SMAD domain [49880] (5 proteins)
  6. 2387774Protein automated matches [323874] (1 species)
    not a true protein
  7. 2387775Species Human (Homo sapiens) [TaxId:9606] [323875] (3 PDB entries)
  8. 2387780Domain d5zoja_: 5zoj A: [358772]
    automated match to d1mk2a_
    protein/DNA complex

Details for d5zoja_

PDB Entry: 5zoj (more details), 2.79 Å

PDB Description: crystal structure of human smad2-man1 complex
PDB Compounds: (A:) Mothers against decapentaplegic homolog 2

SCOPe Domain Sequences for d5zoja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zoja_ b.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnrnatvemtr
rhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqe
faallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwl
dkvltqm

SCOPe Domain Coordinates for d5zoja_:

Click to download the PDB-style file with coordinates for d5zoja_.
(The format of our PDB-style files is described here.)

Timeline for d5zoja_: