Class b: All beta proteins [48724] (178 folds) |
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) has a few short helices inserted in loops |
Family b.26.1.1: SMAD domain [49880] (5 proteins) |
Protein automated matches [323874] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [323875] (3 PDB entries) |
Domain d5zoja_: 5zoj A: [358772] automated match to d1mk2a_ protein/DNA complex |
PDB Entry: 5zoj (more details), 2.79 Å
SCOPe Domain Sequences for d5zoja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zoja_ b.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} epafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnrnatvemtr rhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqe faallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwl dkvltqm
Timeline for d5zoja_: