Lineage for d1dot_2 (1dot 335-686)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28131Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 28132Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 28288Family c.94.1.2: Transferrin [53888] (3 proteins)
  6. 28333Protein Ovotransferrin [53894] (2 species)
  7. 28342Species Duck (Anas platyrhynchos) [TaxId:8839] [53895] (3 PDB entries)
  8. 28345Domain d1dot_2: 1dot 335-686 [35877]

Details for d1dot_2

PDB Entry: 1dot (more details), 2.35 Å

PDB Description: crystallographic structure of duck ovotransferrin at 2.3 angstroms resolution

SCOP Domain Sequences for d1dot_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dot_2 c.94.1.2 (335-686) Ovotransferrin {Duck (Anas platyrhynchos)}
qltvgprenkiqwcavgkdekskcdrwsvvsngevectilddnkdcivkitkgeadaisl
dggfvytagvcglvpvvgesyedetqcskdeeqpayyfavavvkkssaitwnnlqgkksc
htavgrtagwnipmglihnktgscdfddyfsegcapgsppnsrlcklcqgsgenllekcv
asshekyygytgalrclveqgdvafikhstvgenvsgsnkddwakgltrddfellctngk
raktmdyktchlakvpthavvarpekankirellegqeklfglhgtekerfmmfqsqtkd
llfkaltkclvklrqgitykeflgdeyyasvaslntcnpsdllqvctfledk

SCOP Domain Coordinates for d1dot_2:

Click to download the PDB-style file with coordinates for d1dot_2.
(The format of our PDB-style files is described here.)

Timeline for d1dot_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dot_1