Lineage for d5zojc_ (5zoj C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. Family b.26.1.1: SMAD domain [49880] (5 proteins)
  6. Protein automated matches [323874] (1 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [323875] (2 PDB entries)
  8. Domain d5zojc_: 5zoj C: [358758]
    automated match to d1mk2a_
    protein/DNA complex

Details for d5zojc_

PDB Entry: 5zoj (more details), 2.79 Å

PDB Description: crystal structure of human smad2-man1 complex
PDB Compounds: (C:) Mothers against decapentaplegic homolog 2

SCOPe Domain Sequences for d5zojc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zojc_ b.26.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnrnatvemtrr
higrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqef
aallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwld
kvltqm

SCOPe Domain Coordinates for d5zojc_ are not available.

Timeline for d5zojc_:

Domains from other chains:
(mouse over for more information)
d5zoja_, d5zojb_