Lineage for d1ovba_ (1ovb A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880102Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 1880178Protein Ovotransferrin [53894] (2 species)
  7. 1880193Species Duck (Anas platyrhynchos) [TaxId:8839] [53895] (5 PDB entries)
  8. 1880196Domain d1ovba_: 1ovb A: [35875]
    domain II in the N-terminal lobe
    complexed with co3, fe

Details for d1ovba_

PDB Entry: 1ovb (more details), 2.3 Å

PDB Description: the mechanism of iron uptake by transferrins: the structure of an 18kd nii-domain fragment at 2.3 angstroms resolution
PDB Compounds: (A:) Ovotransferrin

SCOPe Domain Sequences for d1ovba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovba_ c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 8839]}
syyavavvkkgtdfmikdlrgktschtglgrsagwnipigtlihrediewegiesgsveq
avakffsascvpgatieqklcrqckgdaktkclrnapysgysgafqclkdgkgdvafvkh
ttvqenapeekdeyellcldgsrqpvdsyktcnwarvaa

SCOPe Domain Coordinates for d1ovba_:

Click to download the PDB-style file with coordinates for d1ovba_.
(The format of our PDB-style files is described here.)

Timeline for d1ovba_: