Lineage for d1ovb__ (1ovb -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28131Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 28132Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 28288Family c.94.1.2: Transferrin [53888] (3 proteins)
  6. 28333Protein Ovotransferrin [53894] (2 species)
  7. 28342Species Duck (Anas platyrhynchos) [TaxId:8839] [53895] (3 PDB entries)
  8. 28343Domain d1ovb__: 1ovb - [35875]

Details for d1ovb__

PDB Entry: 1ovb (more details), 2.3 Å

PDB Description: the mechanism of iron uptake by transferrins: the structure of an 18kd nii-domain fragment at 2.3 angstroms resolution

SCOP Domain Sequences for d1ovb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovb__ c.94.1.2 (-) Ovotransferrin {Duck (Anas platyrhynchos)}
syyavavvkkgtdfmikdlrgktschtglgrsagwnipigtlihrediewegiesgsveq
avakffsascvpgatieqklcrqckgdaktkclrnapysgysgafqclkdgkgdvafvkh
ttvqenapeekdeyellcldgsrqpvdsyktcnwarvaa

SCOP Domain Coordinates for d1ovb__:

Click to download the PDB-style file with coordinates for d1ovb__.
(The format of our PDB-style files is described here.)

Timeline for d1ovb__: