Lineage for d5zzbd1 (5zzb D:5-146)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. Protein automated matches [226905] (13 species)
    not a true protein
  7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (15 PDB entries)
  8. Domain d5zzbd1: 5zzb D:5-146 [358731]
    automated match to d1wuaa1
    complexed with atp, ca, lab

Details for d5zzbd1

PDB Entry: 5zzb (more details), 2.3 Å

PDB Description: lokiprofilin2/rabbit actin complex
PDB Compounds: (D:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d5zzbd1:

Sequence, based on SEQRES records: (download)

>d5zzbd1 c.55.1.1 (D:5-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d5zzbd1 c.55.1.1 (D:5-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqkdsyvgdeaqskrgiltlkypie
hgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpam
yvaiqavlslyasg

SCOPe Domain Coordinates for d5zzbd1 are not available.

Timeline for d5zzbd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zzbd2
View in 3D
Domains from other chains:
(mouse over for more information)
d5zzbb1, d5zzbb2