Lineage for d1b7ua1 (1b7u A:1-333)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522358Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2522359Protein Lactoferrin [53889] (6 species)
  7. 2522399Species Horse (Equus caballus) [TaxId:9796] [53893] (7 PDB entries)
  8. 2522412Domain d1b7ua1: 1b7u A:1-333 [35873]

Details for d1b7ua1

PDB Entry: 1b7u (more details), 3.8 Å

PDB Description: structure of mare apolactoferrin: the n and c lobes are in the closed form
PDB Compounds: (A:) protein (apolactoferrin)

SCOPe Domain Sequences for d1b7ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7ua1 c.94.1.2 (A:1-333) Lactoferrin {Horse (Equus caballus) [TaxId: 9796]}
aprksvrwctispaeaakcakfqrnmkkvrgpsvscirktssfeciqaiaankadavtld
gglvyeaglhpyklrpvaaevyqtrgkpqtryyavavvkkgsgfqlnqlqgvkschtglg
rsagwnipigtlrpylnwtgppeplqkavanffsascvpcadgkqypnlcrlcagteadk
cacssqepyfgysgafkclengagdvafvkdstvfenlpdeaerdkyellcpdntrkpvd
afkechlarvpshavvarsvdgredliwkllhraqeefgrnkssafqlfgstpgeqdllf
kdsalgfvripsqidsglylganyltatqnlre

SCOPe Domain Coordinates for d1b7ua1:

Click to download the PDB-style file with coordinates for d1b7ua1.
(The format of our PDB-style files is described here.)

Timeline for d1b7ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b7ua2