Lineage for d1b7ua1 (1b7u A:1-333)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28131Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 28132Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 28288Family c.94.1.2: Transferrin [53888] (3 proteins)
  6. 28289Protein Lactoferrin [53889] (4 species)
  7. Species Horse (Equus caballus) [TaxId:9796] [53893] (5 PDB entries)
  8. 28307Domain d1b7ua1: 1b7u A:1-333 [35873]

Details for d1b7ua1

PDB Entry: 1b7u (more details), 3.8 Å

PDB Description: structure of mare apolactoferrin: the n and c lobes are in the closed form

SCOP Domain Sequences for d1b7ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7ua1 c.94.1.2 (A:1-333) Lactoferrin {Horse (Equus caballus)}
aprksvrwctispaeaakcakfqrnmkkvrgpsvscirktssfeciqaiaankadavtld
gglvyeaglhpyklrpvaaevyqtrgkpqtryyavavvkkgsgfqlnqlqgvkschtglg
rsagwnipigtlrpylnwtgppeplqkavanffsascvpcadgkqypnlcrlcagteadk
cacssqepyfgysgafkclengagdvafvkdstvfenlpdeaerdkyellcpdntrkpvd
afkechlarvpshavvarsvdgredliwkllhraqeefgrnkssafqlfgstpgeqdllf
kdsalgfvripsqidsglylganyltatqnlre

SCOP Domain Coordinates for d1b7ua1:

Click to download the PDB-style file with coordinates for d1b7ua1.
(The format of our PDB-style files is described here.)

Timeline for d1b7ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b7ua2