Lineage for d1b7ua1 (1b7u A:1-333)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topology
Family c.94.1.2: Transferrin [53888] (4 proteins)
further duplication: composed of two two-domain lobes
Protein Lactoferrin [53889] (6 species) 
Species Horse (Equus caballus) [TaxId:9796] [53893] (7 PDB entries) 
Domain d1b7ua1: 1b7u A:1-333 [35873]
Details for d1b7ua1
PDB Entry: 1b7u (more details), 3.8 Å
PDB Description: structure of mare apolactoferrin: the n and c lobes are in the closed form
PDB Compounds: (A:) protein (apolactoferrin)SCOPe Domain Sequences for d1b7ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b7ua1 c.94.1.2 (A:1-333) Lactoferrin {Horse (Equus caballus) [TaxId: 9796]}
aprksvrwctispaeaakcakfqrnmkkvrgpsvscirktssfeciqaiaankadavtld
gglvyeaglhpyklrpvaaevyqtrgkpqtryyavavvkkgsgfqlnqlqgvkschtglg
rsagwnipigtlrpylnwtgppeplqkavanffsascvpcadgkqypnlcrlcagteadk
cacssqepyfgysgafkclengagdvafvkdstvfenlpdeaerdkyellcpdntrkpvd
afkechlarvpshavvarsvdgredliwkllhraqeefgrnkssafqlfgstpgeqdllf
kdsalgfvripsqidsglylganyltatqnlre
SCOPe Domain Coordinates for d1b7ua1:
Click to download the PDB-style file with coordinates for d1b7ua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b7ua1:
- d1b7ua1 first appeared (with stable ids) in SCOP 1.55
- d1b7ua1 appears in SCOPe 2.07
View in 3D
