Lineage for d5yhob_ (5yho B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
    duplication: consists of two similar beta-alpha-beta(4) motifs
  4. Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) (S)
    characteristic metal ion (zinc)-binding motif in the putative active site
  5. Family d.290.1.0: automated matches [191426] (1 protein)
    not a true family
  6. Protein automated matches [190613] (9 species)
    not a true protein
  7. Species Klebsiella aerogenes [TaxId:548] [358657] (2 PDB entries)
  8. Domain d5yhob_: 5yho B: [358717]
    automated match to d1xv2a_
    complexed with cl, zn

Details for d5yhob_

PDB Entry: 5yho (more details), 2.4 Å

PDB Description: crystal structure of acetolactate decarboxylase from enterobacter cloacae
PDB Compounds: (B:) alpha-acetolactate decarboxylase

SCOPe Domain Sequences for d5yhob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yhob_ d.290.1.0 (B:) automated matches {Klebsiella aerogenes [TaxId: 548]}
qhpdsviyqtslmsallsgvyegettiadllahgdfglgtfneldgemiafssqvyqlra
dgsaraakpeqktpfavmtwfqpqyrktfdtpvsrqqihdvidqqipsdnlfcalridgn
frhahtrtvprqtppyramtdvlddqpvfrfnqregvlvgfrtpqhmqginvagyhehfi
tddrqggghlldyqlesgvltfgeihklmidlpadsaflqanlhpsnldaairsv

SCOPe Domain Coordinates for d5yhob_ are not available.

Timeline for d5yhob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5yhoa_