SCOPe 2.07: Domain d6cypa2: 6cyp A:91-212

Lineage for d6cypa2 (6cyp A:91-212)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (37 species)
   not a true protein

7. Species Hypocrea jecorina [TaxId:431241] [340063] (6 PDB entries)

8. Domain d6cypa2: 6cyp A:91-212 [358713]
   Other proteins in same PDB: d6cypa1, d6cypb1, d6cypc1, d6cypd1, d6cype1, d6cypf1
   automated match to d5tira2
   complexed with fe; mutant

Details for d6cypa2

PDB Entry: 6cyp, 2 Å

PDB Description: crystal structure analysis of the h75i mutant of superoxide dismutase from trichoderma reesei

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d6cypa2:

Sequence; same for both SEQRES and ATOM records:

>d6cypa2 d.44.1.0 (A:91-212) automated matches {Hypocrea jecorina [TaxId: 431241]}
pdadpasapeltaeiaktwgsldkfkeamgkallgiqgsgwgwlvkegsglrivttkdqd
pvvggevpvfgidmwehayylqylngkaayvdniwkvinwktaeqrfkgdredafkilka
sl

Timeline for d6cypa2:

• d6cypa2 is new in SCOPe 2.07-stable
  
• d6cypa2 appears in the current release, SCOPe 2.08