SCOPe 2.05: Domain d1qjma1: 1qjm A:1-333

Lineage for d1qjma1 (1qjm A:1-333)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Horse (Equus caballus) [TaxId:9796] [53893] (7 PDB entries)

8. Domain d1qjma1: 1qjm A:1-333 [35871]
   complexed with co3, sm

Details for d1qjma1

PDB Entry: 1qjm, 3.4 Å

PDB Description: crystal structure of a complex of lactoferrin with a lanthanide ion (sm3+) at 3.4 angstrom resolution

PDB Compounds: (A:) lactoferrin

SCOPe Domain Sequences for d1qjma1:

Sequence; same for both SEQRES and ATOM records:

>d1qjma1 c.94.1.2 (A:1-333) Lactoferrin {Horse (Equus caballus) [TaxId: 9796]}
aprksvrwctispaeaakcakfqrnmkkvrgpsvscirktssfeciqaiaankadavtld
gglvyeaglhpyklrpvaaevyqtrgkpqtryyavavvkkgsgfqlnqlqgvkschtglg
rsagwnipigtlrpylnwtgppeplqkavanffsascvpcadgkqypnlcrlcagteadk
cacssqepyfgysgafkclengagdvafvkdstvfenlpdeaerdkyellcpdntrkpvd
afkechlarvpshavvarsvdgredliwkllhraqeefgrnkssafqlfgstpgeqdllf
kdsalgfvripsqidsglylganyltatqnlre

Timeline for d1qjma1:

• d1qjma1 first appeared (with stable ids) in SCOP 1.55
  
• d1qjma1 appears in SCOPe 2.04
  
• d1qjma1 appears in SCOPe 2.06
  
• d1qjma1 appears in the current release, SCOPe 2.08