SCOPe 2.08: Domain d1f9ba2: 1f9b A:334-689

Lineage for d1f9ba2 (1f9b A:334-689)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Horse (Equus caballus) [TaxId:9796] [53893] (7 PDB entries)

8. Domain d1f9ba2: 1f9b A:334-689 [35870]
   complexed with 3id, bct, fe

Details for d1f9ba2

PDB Entry: 1f9b, 2.7 Å

PDB Description: melanin protein interaction: x-ray structure of the complex of mare lactoferrin with melanin monomers

PDB Compounds: (A:) lactotransferrin

SCOPe Domain Sequences for d1f9ba2:

Sequence; same for both SEQRES and ATOM records:

>d1f9ba2 c.94.1.2 (A:334-689) Lactoferrin {Horse (Equus caballus) [TaxId: 9796]}
taaevaarrervvwcavgpeeerkckqwsdvsnrkvacasastteecialvlkgeadaln
ldggfiyvagkcglvpvlaenqksqnsnapdcvhrppegylavavvrksdadltwnslsg
kkschtgvgrtaawnipmgllfnqtgsckfdkffsqscapgadpqsslcalcvgnnenen
kcmpnseeryygytgafrclaekagdvafvkdvtvlqntdgknsepwakdlkqedfellc
ldgtrkpvaeaeschlarapnhavvsqsdraqhlkkvlflqqdqfggngpdcpgkfclfk
setknllfndnteclaelqgkttyeqylgseyvtsitnlrrcsssplleacaflra

Timeline for d1f9ba2:

• d1f9ba2 first appeared (with stable ids) in SCOP 1.55
  
• d1f9ba2 appears in SCOPe 2.07