![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (49 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:160488] [334147] (3 PDB entries) |
![]() | Domain d5wphc_: 5wph C: [358635] automated match to d5jtfa_ complexed with blj, na |
PDB Entry: 5wph (more details), 2.19 Å
SCOPe Domain Sequences for d5wphc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wphc_ d.108.1.0 (C:) automated matches {Pseudomonas putida [TaxId: 160488]} gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfls
Timeline for d5wphc_: