Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.2: Transferrin [53888] (4 proteins) further duplication: composed of two two-domain lobes |
Protein Lactoferrin [53889] (6 species) |
Species Domestic water buffalo (Bubalus arnee bubalis) [TaxId:89462] [53892] (2 PDB entries) |
Domain d1biya1: 1biy A:1-333 [35863] complexed with co3, fe |
PDB Entry: 1biy (more details), 3.37 Å
SCOPe Domain Sequences for d1biya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1biya1 c.94.1.2 (A:1-333) Lactoferrin {Domestic water buffalo (Bubalus arnee bubalis) [TaxId: 89462]} aprknvrwctisqpewlkchrwqwrmkklgapsitcvrrafvleciraitekkadavtld ggmvfeagldpyklrpvaaeiygtkespqthyyavavvkkgsnfqldqlqgrnschtglg rsagwnipmgilrpylswtesleplqgavakffsascvpcvdrqaypnlcqlckgegenq cacsprepyfgysgafkclqdgagdvafvkettvfenlpekadrdqyellclnntrapvd afkechlaqvpshavvarsvdgkedliwkllskaqekfgknksgsfqlfgsppgqrdllf kdsalgflripskvdsalylgsryltalknlre
Timeline for d1biya1: