SCOPe 2.03: Domain d1ce2a2: 1ce2 A:334-689

Lineage for d1ce2a2 (1ce2 A:334-689)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Domestic water buffalo (Bubalus arnee bubalis) [TaxId:89462] [53892] (2 PDB entries)

8. Domain d1ce2a2: 1ce2 A:334-689 [35862]
   complexed with co3, fe

Details for d1ce2a2

PDB Entry: 1ce2, 2.5 Å

PDB Description: structure of diferric buffalo lactoferrin at 2.5a resolution

PDB Compounds: (A:) protein (lactoferrin)

SCOPe Domain Sequences for d1ce2a2:

Sequence; same for both SEQRES and ATOM records:

>d1ce2a2 c.94.1.2 (A:334-689) Lactoferrin {Domestic water buffalo (Bubalus arnee bubalis) [TaxId: 89462]}
taeevqarrarvvwcavgpeeqkkcqqwsqqsgqivtcatasttddcialvlkgeadals
ldggyiytagkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkg
kkschtavdrtagwnipmglianqtgscafdeffsqscapgadpksrlcalcagddqgld
kcvpnskekyygytgafrclaedvgdvafvkndtvwentngestadwaknlnredfrllc
ldgtrkpvteaqschlavapnhavvslseraahveqvllhqqalfgengkncpdkfclfk
setknllfndnteclaklggrptyeeylgteyvtaianlkkcstsplleacafltr

Timeline for d1ce2a2:

• d1ce2a2 first appeared (with stable ids) in SCOP 1.55
  
• d1ce2a2 appears in SCOPe 2.02
  
• d1ce2a2 appears in SCOPe 2.04
  
• d1ce2a2 appears in the current release, SCOPe 2.08