Lineage for d1blf_1 (1blf 5-333)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.2: Transferrin [53888] (3 proteins) 
Protein Lactoferrin [53889] (4 species) 
Species Cow (Bos taurus) [TaxId:9913] [53891] (1 PDB entry) 
Domain d1blf_1: 1blf 5-333 [35859]
Details for d1blf_1
PDB Entry: 1blf (more details), 2.8 Å
PDB Description: structure of diferric bovine lactoferrin at 2.8 angstroms resolution
SCOP Domain Sequences for d1blf_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1blf_1 c.94.1.2 (5-333) Lactoferrin {Cow (Bos taurus)}
nvrwctisqpewfkcrrwqwrmkklgapsitcvrrafaleciraiaekkadavtldggmv
feagrdpyklrpvaaeiygtkespqthyyavavvkkgsnfqldqlqgrkschtglgrsag
wiipmgilrpylswtesleplqgavakffsascvpcidrqaypnlcqlckgegenqcacs
srepyfgysgafkclqdgagdvafvkettvfenlpekadrdqyellclnnsrapvdafke
chlaqvpshavvarsvdgkedliwkllskaqekfgknksrsfqlfgsppgqrdllfkdsa
lgflripskvdsalylgsrylttlknlre
SCOP Domain Coordinates for d1blf_1:
Click to download the PDB-style file with coordinates for d1blf_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1blf_1:
- d1blf_1 appears in SCOP 1.57
- d1blf_1 appears in the current release, SCOPe 2.08, called d1blfa1
View in 3D
