Lineage for d1lgbc_ (1lgb C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 711143Family c.94.1.2: Transferrin [53888] (3 proteins)
    further duplication: composed of two two-domain lobes
  6. 711144Protein Lactoferrin [53889] (6 species)
  7. 711209Species Human (Homo sapiens) [TaxId:9606] [53890] (22 PDB entries)
  8. 711243Domain d1lgbc_: 1lgb C: [35858]
    Other proteins in same PDB: d1lgb.1
    N2-fragment (one domain fragment)
    complexed with ca, fuc, gal, man, mn, nag

Details for d1lgbc_

PDB Entry: 1lgb (more details), 3.3 Å

PDB Description: interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety
PDB Compounds: (C:) lactotransferrin (n2 fragment)

SCOP Domain Sequences for d1lgbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lgbc_ c.94.1.2 (C:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]}
hyyavavvkkggsfqlnelqglkschtglrrtagwnvpigtlrpflnwtgppepieaava
rffsascvpgadkgqfpnlcrlcagtgenkcafssqepyfsysgafkclkdgagdvafir
estvfedlsdeaerdeyellcpdntrkpvdkfkdchlar

SCOP Domain Coordinates for d1lgbc_:

Click to download the PDB-style file with coordinates for d1lgbc_.
(The format of our PDB-style files is described here.)

Timeline for d1lgbc_: