![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.2: Transferrin [53888] (3 proteins) further duplication: composed of two two-domain lobes |
![]() | Protein Lactoferrin [53889] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53890] (20 PDB entries) |
![]() | Domain d1lgbc_: 1lgb C: [35858] Other proteins in same PDB: d1lgb.1 N2-fragment (one domain fragment) complexed with ca, fuc, gal, man, mn, nag |
PDB Entry: 1lgb (more details), 3.3 Å
SCOP Domain Sequences for d1lgbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lgbc_ c.94.1.2 (C:) Lactoferrin {Human (Homo sapiens)} hyyavavvkkggsfqlnelqglkschtglrrtagwnvpigtlrpflnwtgppepieaava rffsascvpgadkgqfpnlcrlcagtgenkcafssqepyfsysgafkclkdgagdvafir estvfedlsdeaerdeyellcpdntrkpvdkfkdchlar
Timeline for d1lgbc_: