Lineage for d1lgbc_ (1lgb C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75273Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 75274Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 75451Family c.94.1.2: Transferrin [53888] (3 proteins)
  6. 75452Protein Lactoferrin [53889] (5 species)
  7. 75475Species Human (Homo sapiens) [TaxId:9606] [53890] (15 PDB entries)
  8. 75498Domain d1lgbc_: 1lgb C: [35858]
    Other proteins in same PDB: d1lgb.1

Details for d1lgbc_

PDB Entry: 1lgb (more details), 3.3 Å

PDB Description: interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety

SCOP Domain Sequences for d1lgbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lgbc_ c.94.1.2 (C:) Lactoferrin {Human (Homo sapiens)}
hyyavavvkkggsfqlnelqglkschtglrrtagwnvpigtlrpflnwtgppepieaava
rffsascvpgadkgqfpnlcrlcagtgenkcafssqepyfsysgafkclkdgagdvafir
estvfedlsdeaerdeyellcpdntrkpvdkfkdchlar

SCOP Domain Coordinates for d1lgbc_:

Click to download the PDB-style file with coordinates for d1lgbc_.
(The format of our PDB-style files is described here.)

Timeline for d1lgbc_: