Lineage for d1lfh_2 (1lfh 335-691)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.2: Transferrin [53888] (3 proteins) 
Protein Lactoferrin [53889] (4 species) Species Human (Homo sapiens) [TaxId:9606] [53890] (15 PDB entries) 
Domain d1lfh_2: 1lfh 335-691 [35857]
Details for d1lfh_2
PDB Entry: 1lfh (more details), 2.8 Å
PDB Description: molecular replacement solution of the structure of apolactoferrin, a protein displaying large-scale conformational change
SCOP Domain Sequences for d1lfh_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lfh_2 c.94.1.2 (335-691) Lactoferrin {Human (Homo sapiens)}
eeevaarrarvvwcavgeqelrkcnqwsglsegsvtcssasttedcialvlkgeadamsl
dggyvytagkcglvpvlaenyksqqssdpdpncvdrpvegylavavvrrsdtsltwnsvk
gkkschtavdrtagwnipmgllfnqtgsckfdeyfsqscapgsdprsnlcalcigdeege
nkcvpnsneryygytgafrclaenagdvafvkdvtvlqntdgnnneawakdlkladfall
cldgkrkpvtearschlamapnhavvsrmdkverlkqvllhqqakfgrngsdcpdkfclf
qsetknllfndnteclarlhgkttyekylgpqyvagitnlkkcstsplleaceflrk
SCOP Domain Coordinates for d1lfh_2:
Click to download the PDB-style file with coordinates for d1lfh_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lfh_2:
- d1lfh_2 appears in SCOP 1.57
- d1lfh_2 appears in the current release, SCOPe 2.08, called d1lfha2
View in 3D
