SCOPe 2.08: Domain d6cyqc_: 6cyq C:

Lineage for d6cyqc_ (6cyq C:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (111 PDB entries)

8. Domain d6cyqc_: 6cyq C: [358540]
   automated match to d4pm5a_
   complexed with ce4, gol

Details for d6cyqc_

PDB Entry: 6cyq, 1.7 Å

PDB Description: crystal structure of ctx-m-14 s70g/n106s beta-lactamase in complex with hydrolyzed cefotaxime

PDB Compounds: (C:) Beta-lactamase

SCOPe Domain Sequences for d6cyqc_:

Sequence; same for both SEQRES and ATOM records:

>d6cyqc_ e.3.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
savqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqsetq
kqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
vtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraql
vtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpq
qnaesrrdvlasaariiaeg

Timeline for d6cyqc_:

• d6cyqc_ first appeared in SCOPe 2.07