SCOPe 2.08: Domain d6gtha_: 6gth A:

Lineage for d6gtha_ (6gth A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [188184] (14 PDB entries)

8. Domain d6gtha_: 6gth A: [358539]
   automated match to d1ylta_
   complexed with nxl

Details for d6gtha_

PDB Entry: 6gth, 1.69 Å

PDB Description: serial femtosecond crystallography at megahertz pulse rates

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6gtha_:

Sequence; same for both SEQRES and ATOM records:

>d6gtha_ e.3.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
savqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetq
kqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
vtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraql
vtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpq
qnaesrrdvlasaariiaeg

Timeline for d6gtha_:

• d6gtha_ first appeared in SCOPe 2.07