Lineage for d6gtha_ (6gth A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. Protein automated matches [190161] (29 species)
    not a true protein
  7. Species Klebsiella pneumoniae [TaxId:573] [188184] (14 PDB entries)
  8. Domain d6gtha_: 6gth A: [358539]
    automated match to d1ylta_
    complexed with nxl

Details for d6gtha_

PDB Entry: 6gth (more details), 1.6900000000000002 Å

PDB Description: serial femtosecond crystallography at megahertz pulse rates
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6gtha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gtha_ e.3.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
savqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetq
kqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
vtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraql
vtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpq
qnaesrrdvlasaariiaeg

SCOPe Domain Coordinates for d6gtha_ are not available.

Timeline for d6gtha_: