Lineage for d6g0na_ (6g0n A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335134Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2335407Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2335408Protein automated matches [190108] (21 species)
    not a true protein
  7. 2335485Species Teredinibacter turnerae [TaxId:377629] [358534] (4 PDB entries)
  8. 2335489Domain d6g0na_: 6g0n A: [358535]
    automated match to d2drra_
    complexed with gol, xyp; mutant

Details for d6g0na_

PDB Entry: 6g0n (more details), 1.8 Å

PDB Description: crystal structure of a gh8 catalytic mutant xylohexaose complex xylanase from teredinibacter turnerae
PDB Compounds: (A:) Glycoside hydrolase family 8 domain protein

SCOPe Domain Sequences for d6g0na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g0na_ a.102.1.0 (A:) automated matches {Teredinibacter turnerae [TaxId: 377629]}
gavatgeyrnlfaeigkseidiqrkideafqhlfygdakdaavyyqaggnengplayvyd
vnsndvrsegmsygmmitvqmdkkaefdaiwnwaktymyqdspthpafgyfawsmrrdgv
anddmpapdgeeyfvtalyfaaarwgngegifnyqqeadtilsrmrhrqvitgptnrgvm
tatnlfhpeeaqvrftpdinnadhtdasyhlpsfyeiwarvapqedrafwakaadvsrdy
fakaahpvtaltpdygnfdgtpwaaswrpesvdfrynawrsvmnwsmdyawwgkdsgapa
rsdkllaffetqegkmnhlysldgkplgggptlglismnataamaatdprwhnfveklwq
qqpptgqyryydgvlylmallhcageykawip

SCOPe Domain Coordinates for d6g0na_:

Click to download the PDB-style file with coordinates for d6g0na_.
(The format of our PDB-style files is described here.)

Timeline for d6g0na_: