Lineage for d1bka_2 (1bka 335-691)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28131Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 28132Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 28288Family c.94.1.2: Transferrin [53888] (3 proteins)
  6. 28289Protein Lactoferrin [53889] (4 species)
  7. 28309Species Human (Homo sapiens) [TaxId:9606] [53890] (15 PDB entries)
  8. 28327Domain d1bka_2: 1bka 335-691 [35853]

Details for d1bka_2

PDB Entry: 1bka (more details), 2.4 Å

PDB Description: oxalate-substituted diferric lactoferrin

SCOP Domain Sequences for d1bka_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bka_2 c.94.1.2 (335-691) Lactoferrin {Human (Homo sapiens)}
eeevaarrarvvwcavgeqelrkcnqwsglsegsvtcssasttedcialvlkgeadamsl
dggyvytagkcglvpvlaenyksqqssdpdpncvdrpvegylavavvrrsdtsltwnsvk
gkkschtavdrtagwnipmgllfnqtgsckfdeyfsqscapgsdprsnlcalcigdeqge
nkcvpnsneryygytgafrclaenagdvafvkdvtvlqntdgnnneawakdlkladfall
cldgkrkpvtearschlamapnhavvsrmdkverlkqvllhqqakfgrngsdcpdkfclf
qsetknllfndnteclarlhgkttyekylgpqyvagitnlkkcstsplleaceflrk

SCOP Domain Coordinates for d1bka_2:

Click to download the PDB-style file with coordinates for d1bka_2.
(The format of our PDB-style files is described here.)

Timeline for d1bka_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bka_1