Lineage for d6gy1a_ (6gy1 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. Protein Catechol O-methyltransferase, COMT [53337] (2 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (87 PDB entries)
  8. Domain d6gy1a_: 6gy1 A: [358529]
    automated match to d5k0na_
    complexed with dms, fgq, mg, sah

Details for d6gy1a_

PDB Entry: 6gy1 (more details), 2.1 Å

PDB Description: rat comt in complex with inhibitor
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d6gy1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gy1a_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqg

SCOPe Domain Coordinates for d6gy1a_ are not available.

Timeline for d6gy1a_: