Lineage for d6d5xb_ (6d5x B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2705262Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 2705281Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 2705282Protein automated matches [190652] (6 species)
    not a true protein
  7. 2705297Species Human (Homo sapiens) [TaxId:9606] [187855] (3 PDB entries)
  8. 2705299Domain d6d5xb_: 6d5x B: [358527]
    automated match to d2idxb_
    complexed with 3po, 5ad, atp, b12, mg, so4

Details for d6d5xb_

PDB Entry: 6d5x (more details), 2.4 Å

PDB Description: structure of human atp:cobalamin adenosyltransferase bound to atp, adenosylcobalamin, and triphosphate
PDB Compounds: (B:) Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial

SCOPe Domain Sequences for d6d5xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d5xb_ a.25.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kiytktgdkgfsstftgerrpkddqvfeavgttdelssaigfalelvtekghtfaeelqk
iqctlqdvgsalatpcssareahlkyttfkagpileleqwidkytsqlppltafilpsgg
kissalhfcravcrraerrvvplvqmgetdanvakflnrlsdylftlaryaamkegnqek
iym

SCOPe Domain Coordinates for d6d5xb_:

Click to download the PDB-style file with coordinates for d6d5xb_.
(The format of our PDB-style files is described here.)

Timeline for d6d5xb_: