SCOPe 2.06: Domain d1bkaa1: 1bka A:4-334

Lineage for d1bkaa1 (1bka A:4-334)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53890] (21 PDB entries)

8. Domain d1bkaa1: 1bka A:4-334 [35852]
   complexed with fe, oxl

Details for d1bkaa1

PDB Entry: 1bka, 2.4 Å

PDB Description: oxalate-substituted diferric lactoferrin

PDB Compounds: (A:) lactoferrin

SCOPe Domain Sequences for d1bkaa1:

Sequence; same for both SEQRES and ATOM records:

>d1bkaa1 c.94.1.2 (A:4-334) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]}
rsvqwcavsqpeatkcfqwqrnmrkvrgppvscikrdspiqciqaiaenradavtldggf
iyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglrrta
gwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenkcaf
ssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvdkfk
dchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllfkds
aigfsrvppridsglylgsgyftaiqnlrks

Timeline for d1bkaa1:

• d1bkaa1 first appeared (with stable ids) in SCOP 1.55, called d1bka_1
  
• d1bkaa1 appears in SCOPe 2.05
  
• d1bkaa1 appears in SCOPe 2.07
  
• d1bkaa1 appears in the current release, SCOPe 2.08