Lineage for d6h7va_ (6h7v A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3022096Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 3022367Family f.4.3.0: automated matches [267625] (1 protein)
    not a true family
  6. 3022368Protein automated matches [267676] (11 species)
    not a true protein
  7. 3022379Species Acinetobacter baumannii [TaxId:575584] [358518] (1 PDB entry)
  8. 3022380Domain d6h7va_: 6h7v A: [358519]
    automated match to d5fp1a_
    complexed with c8e, edo

Details for d6h7va_

PDB Entry: 6h7v (more details), 2.54 Å

PDB Description: crystal structure of baua, the ferric preacinetobactin receptor from acinetobacter baumannii
PDB Compounds: (A:) Ligand-gated channel protein

SCOPe Domain Sequences for d6h7va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h7va_ f.4.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
ddtyaggqvatssnvgflgskkfldtpfntisytdkyiedkqakditeviaatdpsiytn
gasggwsenyyirgyasstndmsmnglfgitpfyrtspemfgrvevlkgpsallngmppa
gsvggtvnlvtkyaadepfarltttymsdaqfgghvdvgrrfgenkefgvringmyrdgd
aavndqskesrlfslgldwqgenarvfvdaydaldhvdgvtrgvnvstavgipkppkadt
llspdwgsvetkdkgamirgeydfsdqlmayaaygqstteykyngasagtitsstgtlss
tlgqlafdvdkksadagfkgkfetgsvkhqwvanatyynhtqddysyriipgfsdpvitn
iydpnpnwgpkpeftppflfhstlstssfgladtlsfaqdkvqltlglrhqtvkatssvn
tlpenaksattpgvallikatdkisvyanyiegltkgdqapatasnpgeifppqktkqqe
lglkvdlgtfahtlsafeitkpssyldpsklvnnlptfvsdgeqrnrgiewsffgspieh
vrlmggftyldpeltktksggndghtavavpknqaklgaewdtqvaqgtltlsgninavs
kqyinaentlsvpgrtlldvgarystkvedhpvtfraniynltnkaywaqpqltnlalga
prtymlsvsydf

SCOPe Domain Coordinates for d6h7va_:

Click to download the PDB-style file with coordinates for d6h7va_.
(The format of our PDB-style files is described here.)

Timeline for d6h7va_: