Lineage for d1lfia1 (1lfi A:1-334)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163256Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2163257Protein Lactoferrin [53889] (6 species)
  7. 2163310Species Human (Homo sapiens) [TaxId:9606] [53890] (21 PDB entries)
  8. 2163328Domain d1lfia1: 1lfi A:1-334 [35850]
    complexed with co3, cu, nag

Details for d1lfia1

PDB Entry: 1lfi (more details), 2.1 Å

PDB Description: metal substitution in transferrins: the crystal structure of human copper-lactoferrin at 2.1 angstroms resolution
PDB Compounds: (A:) lactoferrin

SCOPe Domain Sequences for d1lfia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lfia1 c.94.1.2 (A:1-334) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]}
grrrsvqwcavsnpeatkcfqwqrnmrkvrgppvscikrdspiqciqaiaenradavtld
ggfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglr
rtagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenk
cafssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvd
kfkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllf
kdsaigfsrvppridsglylgsgyftaiqnlrks

SCOPe Domain Coordinates for d1lfia1:

Click to download the PDB-style file with coordinates for d1lfia1.
(The format of our PDB-style files is described here.)

Timeline for d1lfia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lfia2