Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
Family a.25.2.0: automated matches [191442] (1 protein) not a true family |
Protein automated matches [190652] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187855] (3 PDB entries) |
Domain d6d5kb_: 6d5k B: [358481] automated match to d2idxb_ complexed with 5ad, atp, b12, epe, mg, so4 |
PDB Entry: 6d5k (more details), 2.85 Å
SCOPe Domain Sequences for d6d5kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d5kb_ a.25.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kiytktgdkgfsstftgerrpkddqvfeavgttdelssaigfalelvtekghtfaeelqk iqctlqdvgsalatpcssareahlkyttfkagpileleqwidkytsqlppltafilpsgg kissalhfcravcrraerrvvplvqmgetdanvakflnrlsdylftlaryaamkegnqek iy
Timeline for d6d5kb_: