![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Mitochondrial cytochrome c [46642] (7 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries) Uniprot P00044 |
![]() | Domain d6egya_: 6egy A: [358471] automated match to d5t8wa_ complexed with b4t, hec, so4 |
PDB Entry: 6egy (more details), 2.7 Å
SCOPe Domain Sequences for d6egya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6egya_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
Timeline for d6egya_: