SCOPe 2.07: Domain d6cg9b1: 6cg9 B:4-254

Lineage for d6cg9b1 (6cg9 B:4-254)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.0: automated matches [191424] (1 protein)
   not a true family

6. Protein automated matches [190605] (25 species)
   not a true protein

7. Species Zea mays [TaxId:4577] [358451] (1 PDB entry)

8. Domain d6cg9b1: 6cg9 B:4-254 [358467]
   Other proteins in same PDB: d6cg9b2
   automated match to d4mkna_
   complexed with act, gol

Details for d6cg9b1

PDB Entry: 6cg9, 1.8 Å

PDB Description: crystal structure of triosephosphate isomerase from zea mays (mexican corn)

PDB Compounds: (B:) Triosephosphate isomerase, cytosolic

SCOPe Domain Sequences for d6cg9b1:

Sequence; same for both SEQRES and ATOM records:

>d6cg9b1 c.1.1.0 (B:4-254) automated matches {Zea mays [TaxId: 4577]}
mgrkffvggnwkcngttdqvekivktlnegqvppsdvvevvvsppyvflpvvksqlrqef
hvaaqncwvkkggaftgevsaemlvnlgvpwvilghserrallgesnefvgdkvayalsq
glkviacvgetleqreagstmdvvaaqtkaiaekikdwsnvvvayepvwaigtgkvatpa
qaqevhaslrdwlktnaspevaestriiyggsvtaanckelaaqpdvdgflvggaslkpe
fidiinaatvk

Timeline for d6cg9b1:

• d6cg9b1 is new in SCOPe 2.07-stable
  
• d6cg9b1 appears in the current release, SCOPe 2.08