Lineage for d6cysd2 (6cys D:91-212)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. Protein automated matches [226860] (37 species)
    not a true protein
  7. Species Hypocrea jecorina [TaxId:431241] [340063] (6 PDB entries)
  8. Domain d6cysd2: 6cys D:91-212 [358458]
    Other proteins in same PDB: d6cysa1, d6cysb1, d6cysc1, d6cysd1
    automated match to d5tira2
    complexed with fe; mutant

Details for d6cysd2

PDB Entry: 6cys (more details), 1.85 Å

PDB Description: crystal structure analysis of the d150g mutant of superoxide dismutase from trichoderma reesei
PDB Compounds: (D:) superoxide dismutase

SCOPe Domain Sequences for d6cysd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cysd2 d.44.1.0 (D:91-212) automated matches {Hypocrea jecorina [TaxId: 431241]}
pdadpasapeltaeiaktwgsldkfkeamgkallgiqgsgwgwlvkegsglrivttkdqg
pvvggevpvfgidmwehayylqylngkaayvdniwkvinwktaeqrfkgdredafkilka
sl

SCOPe Domain Coordinates for d6cysd2 are not available.

Timeline for d6cysd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6cysd1
View in 3D
Domains from other chains:
(mouse over for more information)
d6cysa1, d6cysa2, d6cysb1, d6cysb2, d6cysc1, d6cysc2