Lineage for d6dura_ (6dur A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. Family c.67.1.2: Beta-eliminating lyases [53397] (3 proteins)
  6. Protein Tyrosine phenol-lyase [53398] (3 species)
  7. Species Citrobacter freundii [TaxId:546] [419777] (13 PDB entries)
  8. Domain d6dura_: 6dur A: [358449]
    automated match to d2vlfa_
    complexed with k, p33, p70, p71, pge

Details for d6dura_

PDB Entry: 6dur (more details), 1.8 Å

PDB Description: citrobacter freundii tyrosine phenol-lyase complexed with l- phenylalanine
PDB Compounds: (A:) tyrosine phenol-lyase

SCOPe Domain Sequences for d6dura_:

Sequence, based on SEQRES records: (download)

>d6dura_ c.67.1.2 (A:) Tyrosine phenol-lyase {Citrobacter freundii [TaxId: 546]}
nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
vtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeiv
hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
paqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvva
dgiiklyqhkedirglkfiyepkqlrfftarfdyi

Sequence, based on observed residues (ATOM records): (download)

>d6dura_ c.67.1.2 (A:) Tyrosine phenol-lyase {Citrobacter freundii [TaxId: 546]}
nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
vtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeiv
hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
paqslaasiyvetgvrsmergiisagrnnvhhrpkletvrltiprrvytyahmdvvadgi
iklyqhkedirglkfiyepkqlrfftarfdyi

SCOPe Domain Coordinates for d6dura_ are not available.

Timeline for d6dura_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6durb_