Lineage for d6cyua_ (6cyu A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. Protein automated matches [190161] (29 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [187306] (109 PDB entries)
  8. Domain d6cyua_: 6cyu A: [358446]
    automated match to d4pm5a_
    complexed with ce4

Details for d6cyua_

PDB Entry: 6cyu (more details), 1.82 Å

PDB Description: crystal structure of ctx-m-14 s70g/n106s/d240g beta-lactamase in complex with hydrolyzed cefotaxime
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6cyua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cyua_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqset
qkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp
qqnaesrrdvlasaariiaeg

SCOPe Domain Coordinates for d6cyua_ are not available.

Timeline for d6cyua_: