![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
![]() | Protein automated matches [226860] (38 species) not a true protein |
![]() | Species Hypocrea jecorina [TaxId:431241] [340063] (6 PDB entries) |
![]() | Domain d6cypc2: 6cyp C:91-212 [358428] Other proteins in same PDB: d6cypa1, d6cypb1, d6cypc1, d6cypd1, d6cype1, d6cypf1 automated match to d5tira2 complexed with fe; mutant |
PDB Entry: 6cyp (more details), 2 Å
SCOPe Domain Sequences for d6cypc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cypc2 d.44.1.0 (C:91-212) automated matches {Hypocrea jecorina [TaxId: 431241]} pdadpasapeltaeiaktwgsldkfkeamgkallgiqgsgwgwlvkegsglrivttkdqd pvvggevpvfgidmwehayylqylngkaayvdniwkvinwktaeqrfkgdredafkilka sl
Timeline for d6cypc2: