Lineage for d6buhb_ (6buh B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. Family a.28.1.3: apo-D-alanyl carrier protein [63535] (1 protein)
    automatically mapped to Pfam PF00550
  6. Protein apo-D-alanyl carrier protein [63536] (2 species)
  7. Species Streptococcus thermophilus [TaxId:1308] [358412] (1 PDB entry)
  8. Domain d6buhb_: 6buh B: [358413]
    automated match to d1hqba_

Details for d6buhb_

PDB Entry: 6buh (more details), 3.15 Å

PDB Description: crystal structure of a membrane protein, crystal form ii
PDB Compounds: (B:) D-alanyl carrier protein

SCOPe Domain Sequences for d6buhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6buhb_ a.28.1.3 (B:) apo-D-alanyl carrier protein {Streptococcus thermophilus [TaxId: 1308]}
mdvkaevieiidelfmedvsdmmdedlfdagvldsmgtvelivelesrfdirvpvsefgr
ddwntankivegvtelrna

SCOPe Domain Coordinates for d6buhb_ are not available.

Timeline for d6buhb_:

Domains from other chains:
(mouse over for more information)
d6buha_, d6buhe_, d6buhg_