Lineage for d6b94b_ (6b94 B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. Protein Galectin-1 [100925] (5 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [101638] (32 PDB entries)
    Uniprot P09382
  8. Domain d6b94b_: 6b94 B: [358410]
    automated match to d1gzwa_
    complexed with act, bme

Details for d6b94b_

PDB Entry: 6b94 (more details), 1.8 Å

PDB Description: crystal structure of human galectin-1 in complex with lactulose
PDB Compounds: (B:) galectin-1

SCOPe Domain Sequences for d6b94b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b94b_ b.29.1.3 (B:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

SCOPe Domain Coordinates for d6b94b_ are not available.

Timeline for d6b94b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6b94a_